LL-37
5mg
❄️Lyophilized powder (not reconstituted)
Discount per Quantity
| Quantity | Discount | Price per Unit |
|---|---|---|
| 5 - 10 | 10% | €40.49 |
| 11 - 20 | 15% | €38.24 |
| 21+ | 20% | €35.99 |
Rigorous third-party testing
Every batch of our research chemicals and peptides undergoes independent third-party laboratory testing for purity and identity.
Total: €44.99
LL-37 is supplied as a catalogued research material in 5 mg.
The assigned identity is the human 37-residue CAMP-derived peptide with free termini. Shorter cathelicidin fragments, scrambled LL-37 controls, terminally modified analogues and salt forms are distinct materials.
Chemical properties and registry information
| Property | Value |
|---|---|
| Name and synonyms | Cathelicidin (human), hCAP18 (37-residue C-terminal fragment), FALL-39 |
| Material category | Antimicrobial Peptide |
| Sequence | H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH |
| Molecular formula | C205H340N60O53 |
| Average molecular mass | 4493.33 g/mol |
| CAS Registry Number | 204646-31-9 |
| PubChem CID | CID 16132337 |
| Structural features | Linear peptide, 37 amino acids. Forms an amphipathic alpha-helix. |
| Appearance | White to off-white lyophilised powder |
| Solubility | Soluble in sterile water or dilute aqueous buffers. |
| Physical form | Catalogue vial; exact salt/counter-ion and excipients are batch-specific and must be verified in the CoA and SDS. |
Registry values apply only to the specific molecular entity, sequence, termini and material form. Batch records take precedence over family-level literature identifiers.
The only human cathelicidin, LL-37 is a 37-residue peptide cleaved from the C-terminus of the human cathelicidin antimicrobial protein (hCAP18).
Research background and published evidence
Published research
LL-37 has been studied in vitro in membrane-interaction, microbial, innate-immune and cell-signalling systems. Its conformation and measured response vary strongly with ionic strength, matrix composition, peptide concentration and aggregation state.
Current scientific understanding
The cited mechanistic studies do not authenticate this batch or establish human-use outcomes. Results are highly model- and condition-dependent and cannot be transferred between LL-37, precursor hCAP18, fragments or modified analogues.
Technical comparison
| Aspect | This catalogue material | Comparator |
|---|---|---|
| Identity | Mature human LL-37 sequence, 37 residues | hCAP18: longer human cathelicidin precursor from which LL-37 is proteolytically released |
| Structural distinction | Defined C-terminal 37-residue processed peptide | hCAP18 includes an N-terminal cathelin domain and is not analytically interchangeable with LL-37 |
| Analytical implication | Confirm intact mass, sequence, purity, terminal form, counter-ion and aggregation profile | Functional assay overlap cannot distinguish full-length LL-37 from fragments, scrambled controls or aggregates |
Quality and testing
Quality information is batch- and presentation-specific. Use only the report linked to the exact size and lot. A report listed for another size, lot or similarly named material must not be treated as evidence for this product.
Chromatographic area purity, identity, net peptide or analyte content, water or counter-ion content, sterility, endotoxin and elemental impurities are different measurements. One result does not establish the others. Only tests supported by a visible, matching report should be regarded as available.
Laboratory handling and storage
Store and handle only under the conditions stated on the product label, batch CoA and SDS. Keep the container secured, correctly identified and protected from contamination. Do not infer storage, solvent compatibility or stability from a related compound.
Laboratory preparation, analytical-method selection, risk assessment, personal protective equipment and waste disposal should follow the applicable SDS and the institution's approved procedures.
Regulatory and legal status
| Research-use notice | This material is supplied exclusively for laboratory research by qualified professionals and is not intended for human or veterinary use. Purchasers are responsible for compliance with applicable local requirements. |
Sources and references
- [1] UniProt P49913 — Cathelicidin antimicrobial peptide, human
- [2] PubChem CID 134611881 — human LL-37
- [3] Blood — LL-37 expression and innate-immune research
- [4] Journal of Experimental Medicine — LL-37 cell-signalling study
Frequently Asked Questions
Do the CAS number and PubChem CID apply to every batch form?
Only when the exact sequence or structure, termini, conjugation, salt or counter-ion and hydration state match. The batch CoA and SDS govern; a related-compound identifier must not be substituted.
What does an analytical purity result mean?
It is method- and report-specific. For example, an HPLC area percentage is not automatically the same as identity, net content, sterility, endotoxin status or absence of elemental impurities.
How should the material be stored and handled?
Follow the exact label, batch CoA and SDS together with the institution's risk assessment. Use only storage and stability information linked to the exact material form and batch.