FOXO4
10mg
❄️Lyophilized powder (not reconstituted)
Discount per Quantity
| Quantity | Discount | Price per Unit |
|---|---|---|
| 5 - 10 | 10% | €107.10 |
| 11 - 20 | 15% | €101.15 |
| 21+ | 20% | €95.20 |
Rigorous third-party testing
Every batch of our research chemicals and peptides undergoes independent third-party laboratory testing for purity and identity.
Total: €119.00
FOXO4 is supplied as a catalogued research material in 10mg.
“FOXO4” alone could denote the endogenous protein, a protein fragment, or the FOXO4-DRI peptide reported in the literature. The public catalogue context appears to intend FOXO4-DRI, but the full all-D sequence, TAT segment, termini and salt must be verified before exact registry fields are assigned [1–4].
Chemical properties and registry information
| Property | Value |
|---|---|
| Name and synonyms | Proxofim, FOXO4 D-Retro-Inverso peptide |
| Material category | Senolytic |
| Sequence | H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH |
| Molecular formula | C218H369N81O61 |
| Average molecular mass | 5358.4 g/mol |
| CAS Registry Number | 2199331-64-3 |
| PubChem CID | CID 124082135 |
| Structural features | A chimeric D-Retro-Inverso (DRI) peptide composed of a FOXO4-derived segment linked to a TAT cell-penetrating peptide. The sequence consists of all D-amino acids in reverse order of the parent L-peptide. |
| Appearance | White to off-white lyophilised powder |
| Solubility | Soluble in sterile or bacteriostatic water. The peptide is highly charged and should readily dissolve. |
| Physical form | Catalogue vial; exact salt/counter-ion and excipients are batch-specific and must be verified in the CoA and SDS. |
Registry values apply only to the specific molecular entity, sequence, termini and material form. Batch records take precedence over family-level literature identifiers.
A senolytic agent that induces apoptosis in senescent cells by disrupting the FOXO4-p53 interaction. The D-Retro-Inverso design enhances its stability against proteolytic degradation.
Research background and published evidence
Published research
The originating FOXO4-DRI publication examined disruption of a FOXO4–p53 interaction in cultured cells and mouse models. It provides a preclinical research model and a defined structural hypothesis, not evidence for performance of the catalogue batch [1,2].
Current scientific understanding
The cited work is preclinical. It does not establish human safety, efficacy, anti-ageing effects, recovery effects, dosage, administration, or medicine authorization. Results for the reported FOXO4-DRI construct cannot be transferred to a batch whose construct and salt are unconfirmed [1–4].
FOXO4-DRI is an experimental research construct, not an authorised medicinal product. The catalogue label must not imply equivalence to endogenous FOXO4 or suitability for human use.
Technical comparison
| Aspect | This catalogue material | Comparator |
|---|---|---|
| Identity | Catalogue FOXO4, provisionally mapped to the reported 46-residue FOXO4-DRI peptide | Full-length endogenous human FOXO4 protein |
| Structural distinction | Short retro-inverso peptide with a cell-penetrating segment and reported D stereochemistry | Large naturally translated L-amino-acid transcription-factor protein |
| Analytical implication | Requires intact-mass, sequence, stereochemical, TAT-segment and counter-ion confirmation | Protein identity requires a different sequence, mass and analytical control set |
Quality and testing
Quality information is batch- and presentation-specific. Use only the report linked to the exact size and lot. A report listed for another size, lot or similarly named material must not be treated as evidence for this product.
Chromatographic area purity, identity, net peptide or analyte content, water or counter-ion content, sterility, endotoxin and elemental impurities are different measurements. One result does not establish the others. Only tests supported by a visible, matching report should be regarded as available.
Laboratory handling and storage
Store and handle only under the conditions stated on the product label, batch CoA and SDS. Keep the container secured, correctly identified and protected from contamination. Do not infer storage, solvent compatibility or stability from a related compound.
Laboratory preparation, analytical-method selection, risk assessment, personal protective equipment and waste disposal should follow the applicable SDS and the institution's approved procedures.
Regulatory and legal status
| Research-use notice | This material is supplied exclusively for laboratory research by qualified professionals and is not intended for human or veterinary use. Purchasers are responsible for compliance with applicable local requirements. |
Sources and references
- [1] Baar et al. Targeted apoptosis of senescent cells using FOXO4-DRI: cell and mouse models. Cell (2017).
- [2] WO2016118014A2. Originating patent describing FOXO4-derived retro-inverso constructs.
- [3] PubChem. FOXO4-DRI parent structure, CID 167312269.
- [4] PubChem. Separate FOXO4-DRI acetate representation, CID 167312268.
Frequently Asked Questions
Do the CAS number and PubChem CID apply to every batch form?
Only when the exact sequence or structure, termini, conjugation, salt or counter-ion and hydration state match. The batch CoA and SDS govern; a related-compound identifier must not be substituted.
What does an analytical purity result mean?
It is method- and report-specific. For example, an HPLC area percentage is not automatically the same as identity, net content, sterility, endotoxin status or absence of elemental impurities.
How should the material be stored and handled?
Follow the exact label, batch CoA and SDS together with the institution's risk assessment. Use only storage and stability information linked to the exact material form and batch.