Tesamorelin
❄️Lyophilized powder (not reconstituted)
Size:
Discount per Quantity
| Quantity | Discount | Price per Unit |
|---|---|---|
| 5 - 10 | 10% | €40.49 |
| 11 - 20 | 15% | €38.24 |
| 21+ | 20% | €35.99 |
Rigorous third-party testing
Every batch of our research chemicals and peptides undergoes independent third-party laboratory testing for purity and identity.
Total: €44.99
Tesamorelin is supplied as a catalogued research material in 5 mg and 10 mg.
Tesamorelin is a 44-residue human GRF analogue bearing an N-(trans-3-hexenoyl) group and C-terminal amide. Drug substance is commonly handled as a multi-acetate material, so acetate stoichiometry, N-acylation and intact mass must be verified for the supplied batch [1–3].
Chemical properties and registry information
| Property | Value |
|---|---|
| Name and synonyms | Egrifta, TH9507 |
| Material category | GHRH Analogue |
| Sequence | (trans-Hexenoyl)-YADAIETNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 |
| Molecular formula | C221H366N72O67S |
| Average molecular mass | 5135.78 g/mol |
| CAS Registry Number | 218620-54-1 |
| PubChem CID | CID 16137939 |
| Structural features | A 44-amino acid peptide analogue of human growth hormone-releasing hormone (GHRH) with an N-terminal trans-3-hexenoyl group modification and C-terminal amidation. |
| Appearance | White to off-white lyophilised powder |
| Solubility | Reconstitute with bacteriostatic or sterile water. |
| Physical form | Catalogue vial; exact salt/counter-ion and excipients are batch-specific and must be verified in the CoA and SDS. |
Registry values apply only to the specific molecular entity, sequence, termini and material form. Batch records take precedence over family-level literature identifiers.
A stabilized analogue of GHRH. The N-terminal modification protects the peptide from degradation by dipeptidyl peptidase-4 (DPP-4), extending its half-life and duration of action.
Research background and published evidence
Published research
Defined contexts include human GHRH-receptor binding and signalling, N-acylation structure–activity comparison, intact-mass and counter-ion analysis, and analytical separation from shorter GRF fragments [1–3].
Current scientific understanding
Regulatory and clinical documents describe separately manufactured medicinal material and do not authenticate this catalogue batch. They must not be converted into human-use, efficacy, safety or dosing claims.
Tesamorelin is an approved medicinal active substance in some jurisdictions.
Technical comparison
| Aspect | This catalogue material | Comparator |
|---|---|---|
| Identity | Tesamorelin: N-hexenoylated human GRF(1–44)-NH₂ | Sermorelin: unacylated human GRF(1–29)-NH₂ |
| Structural distinction | 44 residues plus an N-(trans-3-hexenoyl) group | Shorter 29-residue unacylated fragment |
| Analytical implication | Confirm complete 44-residue sequence, N-acyl group, amide and acetate content | Distinct intact mass, retention and impurity reference |
Quality and testing
Quality information is batch- and presentation-specific. Use only the report linked to the exact size and lot. A report listed for another size, lot or similarly named material must not be treated as evidence for this product.
Chromatographic area purity, identity, net peptide or analyte content, water or counter-ion content, sterility, endotoxin and elemental impurities are different measurements. One result does not establish the others. Only tests supported by a visible, matching report should be regarded as available.
Laboratory handling and storage
Store and handle only under the conditions stated on the product label, batch CoA and SDS. Keep the container secured, correctly identified and protected from contamination. Do not infer storage, solvent compatibility or stability from a related compound.
Laboratory preparation, analytical-method selection, risk assessment, personal protective equipment and waste disposal should follow the applicable SDS and the institution's approved procedures.
Regulatory and legal status
| Research-use notice | This material is supplied exclusively for laboratory research by qualified professionals and is not intended for human or veterinary use. Purchasers are responsible for compliance with applicable local requirements. |
Sources and references
- [1] U.S. FDA chemistry review for tesamorelin.
- [2] PubChem. Tesamorelin compound record.
- [3] DailyMed. Tesamorelin product information.
Frequently Asked Questions
Do the CAS number and PubChem CID apply to every batch form?
Only when the exact sequence or structure, termini, conjugation, salt or counter-ion and hydration state match. The batch CoA and SDS govern; a related-compound identifier must not be substituted.
What does an analytical purity result mean?
It is method- and report-specific. For example, an HPLC area percentage is not automatically the same as identity, net content, sterility, endotoxin status or absence of elemental impurities.
How should the material be stored and handled?
Follow the exact label, batch CoA and SDS together with the institution's risk assessment. Use only storage and stability information linked to the exact material form and batch.